SEO Analysis of your site


Complete Detailed Analysis

https://www.kosmotogp.com/

Analyzed on 2017-05-20 14:54:37
Steps to Quick Ranking

About this Analysis


This is a specially targeted analysis of your site https://www.kosmotogp.com/. It points out the most important aspects in terms of user experience as well as search engine exposure that needs attention to start getting traffic and retained visitors.
We have created our own algorithm to score your site. After reviewing thousands of websites in our algorithm, we have noticed that a site which scores 75 and above must be already receiving search engine traffic with good social exposure. If yoursite is anywhere below 75, you need to start acting immediately to improve your website promotion.

Your website Score

Your website social marketing status

The below stats are for your website https://www.kosmotogp.com/ and not your facebook or social pages.

Reddit Shares


0

Total Facebook Likes


54

Pinterest Pins


0

Google Plus:


3

Stumble Upon:


0

Linkedin


0

Alexa Rank:


0


Your website social meter

Search engines have evolved, social status today holds a very important role in search engine ranking. External factors including the social exposure, the number of quality backlinks adds a lot of weightage to rank a website on the search engines.


This pie chart will show you the intensity of popularity over different social media network so that you can concentrate your efforts on the weak areas.

Social Meter:


The Observations


  1. Title

    Rent a scooter Kos island Greece. Scooter, bicycle, ATV, Quad.

    60% Complete

  2. Keywords



  3. Description

    Rent a scooter Kos, Greece. The most popular place to rent a quad, bike or a scooter. Book Online! Free delivery and pickup from your hotel.


  4. Keywords in URL

    Excellent, keywords found in your URL


  5. Alt Tags

  6. You have 4 images without alt tags. out of 18 images on the page.
  7.  Alt tags needs immediate attention

  8. Facebook Likes

    Your facebook likes are 54 and growing, you are on the right track.


  9. Pinterest Pins

    Pinterest Pins are great way of sharing content, your website is only shared 0 times on pinterest, make your content more shareable, join social combo plan


  10. Google Plus

    Your website is not shared on Google plus enough, they are only 3 , It is very crucial for ranking in google, make your content shareable, to speed up, join our social combo.


  11. Linkedin

    Your website is not shared on Linkedin enough, they are only 0 , It is very crucial for ranking in google, make your content shareable, to speed up, join our social combo.


  12. Alexa Rank

    Your website has good traffic, your Alexa Traffic Rank is 0, you are on the right track. If you wish to expedite, join our social combo plan.



  13. Body Text: Keyword cloud showing the most and least used keywords on the page.

    Below are the keywords which are prominently used in your webpage. Kindly review them to make sure you are not using unnecessary keywords not relevant to your business.

    This is very useful to get a bird eye on which keywords are most prominently used on your page. So that you are not diluting the keyword density on untargeted keywords.

    rent scooter kos island greece bicycle atv quad home location gallery contact bike date vehicle extras checkout pickup select pick kosmotogp main office megalou alexandrou achilleas hotel apartments averof alexandra martiou street anastasia ethnikis antistaseos angela aparthotel veriopoulou astron otel akti kountourioti captain yiannis studios koutsouradi amerikis catherine desiree elite apartmnets ethelonton pal polemiston erato venizelou skevou zervou fantasia eleftheriou frosini lambi beach gaia garden lampi area jasmine panagi tsaldari karis bouboulinas koala harmilou bay artemisias kosta palace leonidas sintagmatos dodekanision maritina lordou vironos olympia oscar pavlos mandilara pelagos suites phaethon smartline phillipion vas georgiou thessalou meni cosmopolitan sonia irodotou theonia triton vasileos veroniki return coupon code submit reset type bicyclequadscooter sort latest price high ascending descending details extra personal information email phone country united statesunited kingdomafghanistanalbaniaalgeriaamerican samoaandorraangolaanguillaantarcticaantigua barbudaargentinaarmeniaarubaaustraliaaustriaazerbaijanbahamasbahrainbangladeshbarbadosbelarusbelgiumbelizebeninbermudabhutanboliviabosnia herzegowinabotswanabouvet islandbrazilbritish indian ocean territorybrunei darussalambulgariaburkina fasoburundicambodiacamerooncanadacape verdecayman islandscentral african republicchadchilechinachristmas islandcocos keeling islandscolombiacomoroscongocongo democratic republic thecook islandscosta ricacote ivoirecroatia local hrvatska cubacyprusczech republicdenmarkdjiboutidominicadominican republiceast timorecuadoregyptel salvadorequatorial guineaeritreaestoniaethiopiafalkland islands malvinas faroe islandsfijifinlandfrancefrance metropolitanfrench guianafrench polynesiafrench southern territoriesgabongambiageorgiagermanyghanagibraltargreecegreenlandgrenadaguadeloupeguamguatemalaguineaguinea bissauguyanahaitiheard donald islandsholy vatican city state hondurashong konghungaryicelandindiaindonesiairan islamic iraqirelandisraelitalyjamaicajapanjordankazakhstankenyakiribatikorea people ofkorea ofkuwaitkyrgyzstanlao republiclatvialebanonlesotholiberialibyan arab jamahiriyaliechtensteinlithuanialuxembourgmacaumacedonia yugoslav ofmadagascarmalawimalaysiamaldivesmalimaltamarshall islandsmartiniquemauritaniamauritiusmayottemexicomicronesia federated states ofmoldova ofmonacomongoliamontenegromontserratmoroccomozambiquemyanmarnamibianaurunepalnetherlandsnetherlands antillesnew caledonianew zealandnicaraguanigernigerianiuenorfolk islandnorthern mariana islandsnorwayomanpakistanpalaupanamapapua guineaparaguayperuphilippinespitcairnpolandportugalpuerto ricoqatarreunionromaniarussian federationrwandasaint kitts nevissaint luciasaint vincent grenadinessamoasan marinosao tome principesaudi arabiasenegalserbiaseychellessierra leonesingaporeslovakia slovak sloveniasolomon islandssomaliasouth africasouth georgia south sandwich islandsspainsri lankast helenast pierre miquelonsudansurivaluesvalbard jan mayen islandsswazilandswedenswitzerlandsyrian republictaiwantajikistantanzania ofthailandtogotokelautongatrinidad tobagotunisiaturkeyturkmenistanturks caicos islandstuvaluugandaukraineunited emiratesunited minor outlying islandsuruguayuzbekistanvanuatuvenezuelavietnamvirgin british virgin wallis futuna islandswestern saharayemenzambiazimbabwe comments questions payment method paypal visa mastercard maestro americanexpress number expiration januaryfebruarymarchaprilmayjunejulyaugustseptemberoctobernovemberdecember security agree terms conditions rentals years scooters quads valid class driving license required european union international covered insurance accident fault person allowed drive rocky areas traffic fines incurred rental period renter responsibility gasoline paid customer total cost reservation charged credit card refundable time change days image quantity estimated charge easier place company offer daywhile companies full day count line paymentchoose online secure interface exceptional serviceour experienced dedicated staff ready provide friendly honest caring service early booking offerearly special birds discount limited dropoffwe deliver vehicles requested brand fleetwide range specially tuned fuel consumption kymco quadcc piaggio boulevard agility variant sport citycc quality services prices rentalsrent hiring finally choose choice front working adding methods located heart meters harbor close important archaeological places ancient monuments addition market commercial stores walking distance greecefurthermore bikes selected safety comfort hey constantly maintained trained mechanics highest standards fleet guarantee untroubled tour nicest spots experience stay conclusion hire perfect condition carefully result don waste money pay bills gas station assist sitemap opening hours info tel

  14. Keyphrase found on your page.

    Single Keywords


    hotel, scooter, kos, select, location, quad, megalou, studios, alexandrou, rent, venizelou, republic, vehicle, kosmotogp, island, return, lambi, greece, amerikis, apartments, date, beach, rental, pickup, bike,

    2 Keywords Phrase


    scooter kos,
    megalou alexandrou,
    rent scooter,
    kos island,
    hotel panagi,
    panagi tsaldari,
    return location,
    akti kountourioti,
    eleftheriou venizelou,

    3 Keywords Phrase


    hotel panagi tsaldari,
    driving license required,
    olympia hotel veriopoulou,
    hotel veriopoulou oscar,
    lordou vironos olympia,
    hotel lordou vironos,
    veriopoulou oscar hotel,
    vironos olympia hotel,
    hotel venizelou pavlos,


  15. OnPage Links

    There are total 26 backlinks found on your page out of which 1 are external links

    There are total 1 links without anchor text

    25 Internal Links

    35% Complete (success)

    1 External Links

    20% Complete (warning)
  16. H1 Tags

    • H1

      Rent a scooter Kos island, Greece.

    • You are using H1 tags effectively Content used in the h1 are relevant to the page

  17. H2 Tags

    • H2

      Vehicle Name

    • H2

      Extra Name

    • H2

      kosmotoGP The best place to rent a scooter Kos.

    • You are using H2 effectively Content used in the H2 are relevant to the page

  18. H3 Tags

    • H3

      RENT A SCOOTER ATV BIKE KOS GREECE

    • H3

      Your Personal Information

    • H3

      Payment

    • H3

      Location / Time Change

    • H3

      Vehicle Change

    • H3

      Extras Change

    • H3

      Estimated Charge

    • H3

      24h AS ONE DAY

    • H3

      ON LINE PAYMENT

    • H3

      EXCEPTIONAL SERVICE

    • H3

      EARLY BOOKING OFFER

    • H3

      PICK UP - DROPOFF

    • H3

      BRAND NEW FLEET

    • H3

      KYMCO QUAD.

    • H3

      KYMCO QUAD

    • H3

      PIAGGIO BOULEVARD II.

    • H3

      KYMCO AGILITY 16+

    • H3

      PIAGGIO VARIANT Sport.

    • H3

      KYMCO AGILITY CITY

    • H3

      kosmotoGP Rentals

    • H3

      Megalou Alexandrou 12 st.,

    • H3

      Kos island, Greece

    • H3

      Rent a scooter, Kos Greece.

    • You are using h3 tags effectively
  19. H4 Tags

    • H4

      We are the ONLY Rental Company in Kos island, Greece that we offer:

    • You are using H4 tag effectively
  20. H5 Tags

    • H5

      All our vehicles are brand new and tuned up for very low fuel consumption.

    • H5

      50cc Quad.

    • H5

      300cc QUAD

    • H5

      50cc Scooter.

    • H5

      200cc SCOOTER.

    • H5

      80cc Scooter.

    • H5

      125cc Scooter.

    • You are using H5 tag effectively
  21. H6 Tags

    • H6

      We offer high quality and services, always at the best prices available.

    • You are using H6 tag effectively

    22. Your Page H Tag Structure

    H1


    1

    H2


    3

    H3


    23

    H4


    1

    H5


    7

    H6


    1


    Keep the H tag structure logical


  22. Good you are using Canonical url
  23. You are not using text attributes to highlight important content on your site. Try using them
  24. Good you are using Sitemap file
  25. You are not using robots.txt file. Use it to control who can access your site.
  26. Good you are using favicon
  27. Good, we found a blog on your site
  28. Your page loadtime is optimal. Good Work.
  29. Your website is W3C Validated, Excellent
  30. Good you are using Publisher Tag for Google+
  31. Great, you are using meta viewport to configure other displays
  32. Your website is missing language meta tag, This tag is particularly useful for non-english and multiple language websites. Search engines which indexes websites on base of language read this tag.
  33. Good you are Open Graph Protocol

>> Click Here to Boost your website ranking <<

Things to do


  • Your website has very low traffic, act immediately to improve.
  • Your facebook like requires immediate improvement.
  • Your Google Plus shares are very low, you are ignoring a gold mine.
  • Linkedin shares needs improvement. Use share buttons on your content.
  • Pinterest Shares are very low, Pinterest shares generate a lot of exposure and traffic.
  • Emphasize on your facebook promotion to receive more user inputs, appreciations and comments.
  • Very low stumble upon shares, add social sharing buttons on your site to increase your website exposure.
  • Title of your website needs improvement.
  • Description of your website needs improvement.
  • You can use your keyword tags more effectively.
  • Use strong text attribute to highlight content on your page.
  • Use italics attributes on your page.
  • Use em attribute on your page.
  • Use bold attribute on your page.
  • Use acronym attribute on your page.
  • Use abbr attribute on your page. (for HTML5)
  • Use dfn (definition) tag on your page if appropriate.
  • Use Robots.txt file. Robots file works as a gatekeeper, use it for your benefit.
  • You are not using Language Meta.

Common Todos


  • Set preferred domain (www/non www)
  • Remove Inline CSS
  • Keep text to html ration of atleast 2:1
  • Add Tweet Button
  • Add Facebook Share / Like Button
  • Add Google +1 button
  • Add an Apple Icon
  • Make sure website is responsive
  • Use Breadcrumb to display navigation structure with or without links
  • Use meaningful pagenames rich with keywords.

Guaranteed Ranking with these Secret Steps

We have detailed steps to be applied to your site with your relevant keywords to quickly rank high. Get them for just $25.


LIMITED TIME DISCOUNT